PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1888_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MIKC_MADS
Protein Properties Length: 231aa    MW: 26248.9 Da    PI: 8.1813
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1888_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF1009.5e-32959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Neem_1888_f_1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                   79***********************************************96 PP

2K-box805.6e-27861611186
          K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 
                    ea + s+qqe+ kLk+++e Lqr+qR+llGe+L++Ls keL++Le+qL+ slk+iRs++++++l+ + +lq+k  e
  Neem_1888_f_1  86 EALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLSSKELESLERQLDMSLKQIRSTRTQYMLDTLTDLQHKLME 161
                    4555689*****************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.515161IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.16E-34276IPR002100Transcription factor, MADS-box
CDDcd002659.98E-46276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-33323IPR002100Transcription factor, MADS-box
PfamPF003192.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-333859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.07189174IPR002487Transcription factor, K-box
PfamPF014868.5E-2191159IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0048481Biological Processplant ovule development
GO:0048833Biological Processspecification of floral organ number
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SSMLKTLERY QKCNYGAPEP NVSTREALEL SSQQEYLKLK ARYEALQRSQ RNLLGEELGP  120
LSSKELESLE RQLDMSLKQI RSTRTQYMLD TLTDLQHKLM EGYQVSTLQL NPSAEDVGYG  180
LKPAQTHQGD TFFHPLECEP TLQIGYQPAD PISVVTAGSS VNNYMTGWLP C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A4e-4075158186Developmental protein SEPALLATA 3
4ox0_B4e-4075158186Developmental protein SEPALLATA 3
4ox0_C4e-4075158186Developmental protein SEPALLATA 3
4ox0_D4e-4075158186Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00605ChIP-seqTransfer from AT1G24260Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR1363784e-71KR136378.1 Citrus sinensis cultivar Moro Nucellare 58-8D-1 MADSSEP3-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006437994.11e-157hypothetical protein CICLE_v10032507mg
RefseqXP_006484145.11e-157PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform X4
SwissprotQ034891e-136AGL9_PETHY; Agamous-like MADS-box protein AGL9 homolog
TrEMBLV4VFI61e-157V4VFI6_9R
STRINGGLYMA05G28140.31e-137(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62202644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.31e-123MIKC_MADS family protein